Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 28594..28858 | Replicon | plasmid pMS1050-2 |
| Accession | NZ_CP097728 | ||
| Organism | Escherichia coli strain MS1050 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | M9O78_RS25000 | Protein ID | WP_001331364.1 |
| Coordinates | 28594..28746 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 28801..28858 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O78_RS24975 (23872) | 23872..26034 | + | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
| M9O78_RS24980 (26099) | 26099..26761 | + | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| M9O78_RS24985 (26833) | 26833..27042 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| M9O78_RS24990 (27434) | 27434..27610 | + | 177 | WP_001054904.1 | hypothetical protein | - |
| M9O78_RS24995 (27675) | 27675..27971 | - | 297 | WP_001275298.1 | DinQ-like type I toxin DqlB | - |
| M9O78_RS25000 (28594) | 28594..28746 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (28801) | 28801..28858 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (28801) | 28801..28858 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (28801) | 28801..28858 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (28801) | 28801..28858 | + | 58 | NuclAT_0 | - | Antitoxin |
| M9O78_RS25005 (29038) | 29038..30246 | + | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
| M9O78_RS25010 (30265) | 30265..31335 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| M9O78_RS25015 (31328) | 31328..33619 | + | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) | - | 1..117915 | 117915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T246223 WP_001331364.1 NZ_CP097728:c28746-28594 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246223 NZ_CP097728:28801-28858 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|