Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 174269..174538 | Replicon | plasmid pMS1050-1 |
| Accession | NZ_CP097727 | ||
| Organism | Escherichia coli strain MS1050 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M9O78_RS24660 | Protein ID | WP_096937776.1 |
| Coordinates | 174413..174538 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 174269..174334 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O78_RS24625 | 169299..169724 | - | 426 | WP_015387398.1 | hypothetical protein | - |
| M9O78_RS24630 | 170025..170522 | + | 498 | Protein_176 | single-stranded DNA-binding protein | - |
| M9O78_RS24635 | 170620..170853 | + | 234 | WP_000005988.1 | DUF905 family protein | - |
| M9O78_RS24640 | 170917..172881 | + | 1965 | WP_068862930.1 | ParB/RepB/Spo0J family partition protein | - |
| M9O78_RS24645 | 172950..173384 | + | 435 | WP_000845962.1 | conjugation system SOS inhibitor PsiB | - |
| M9O78_RS24650 | 173381..174143 | + | 763 | Protein_180 | plasmid SOS inhibition protein A | - |
| - | 174112..174336 | + | 225 | NuclAT_0 | - | - |
| - | 174112..174336 | + | 225 | NuclAT_0 | - | - |
| - | 174112..174336 | + | 225 | NuclAT_0 | - | - |
| - | 174112..174336 | + | 225 | NuclAT_0 | - | - |
| - | 174269..174334 | - | 66 | - | - | Antitoxin |
| M9O78_RS24655 | 174322..174471 | + | 150 | Protein_181 | plasmid maintenance protein Mok | - |
| M9O78_RS24660 | 174413..174538 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M9O78_RS24665 | 174839..175112 | - | 274 | Protein_183 | hypothetical protein | - |
| M9O78_RS24670 | 175164..175460 | + | 297 | WP_001272245.1 | hypothetical protein | - |
| M9O78_RS24675 | 175571..176392 | + | 822 | WP_001234487.1 | DUF932 domain-containing protein | - |
| M9O78_RS24680 | 176689..177291 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| M9O78_RS24685 | 177613..177996 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M9O78_RS24690 | 178183..178872 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| M9O78_RS24695 | 178965..179366 | + | 402 | WP_001369361.1 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..203859 | 203859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T246221 WP_096937776.1 NZ_CP097727:174413-174538 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT246221 NZ_CP097727:c174334-174269 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|