Detailed information of TA system TA246221

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 174269..174538
• Replicon: plasmid pMS1050-1
• Accession: NZ_CP097727
• Organism: Escherichia coli strain MS1050

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M9O78_RS24660
• Protein ID: WP_096937776.1
• Coordinates: 174413..174538 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	174269..174334 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M9O78_RS24625	169299..169724	-	426	WP_015387398.1	hypothetical protein	-
M9O78_RS24630	170025..170522	+	498	Protein_176	single-stranded DNA-binding protein	-
M9O78_RS24635	170620..170853	+	234	WP_000005988.1	DUF905 family protein	-
M9O78_RS24640	170917..172881	+	1965	WP_068862930.1	ParB/RepB/Spo0J family partition protein	-
M9O78_RS24645	172950..173384	+	435	WP_000845962.1	conjugation system SOS inhibitor PsiB	-
M9O78_RS24650	173381..174143	+	763	Protein_180	plasmid SOS inhibition protein A	-
-	174112..174336	+	225	NuclAT_0	-	-
-	174112..174336	+	225	NuclAT_0	-	-
-	174112..174336	+	225	NuclAT_0	-	-
-	174112..174336	+	225	NuclAT_0	-	-
-	174269..174334	-	66	-	-	Antitoxin
M9O78_RS24655	174322..174471	+	150	Protein_181	plasmid maintenance protein Mok	-
M9O78_RS24660	174413..174538	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
M9O78_RS24665	174839..175112	-	274	Protein_183	hypothetical protein	-
M9O78_RS24670	175164..175460	+	297	WP_001272245.1	hypothetical protein	-
M9O78_RS24675	175571..176392	+	822	WP_001234487.1	DUF932 domain-containing protein	-
M9O78_RS24680	176689..177291	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
M9O78_RS24685	177613..177996	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M9O78_RS24690	178183..178872	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
M9O78_RS24695	178965..179366	+	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..203859	203859

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T246221 WP_096937776.1 NZ_CP097727:174413-174538 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT246221 NZ_CP097727:c174334-174269 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin