Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 8543..8797 | Replicon | plasmid pMS1050-1 |
| Accession | NZ_CP097727 | ||
| Organism | Escherichia coli strain MS1050 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M9O78_RS23780 | Protein ID | WP_001312851.1 |
| Coordinates | 8648..8797 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 8543..8604 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O78_RS23755 (5291) | 5291..6037 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| M9O78_RS23760 (6096) | 6096..6956 | + | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| M9O78_RS23765 (7059) | 7059..7619 | + | 561 | WP_032072881.1 | fertility inhibition protein FinO | - |
| M9O78_RS23770 (7755) | 7755..7967 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| M9O78_RS23775 (8213) | 8213..8287 | + | 75 | Protein_5 | endonuclease | - |
| - (8543) | 8543..8604 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (8543) | 8543..8604 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (8543) | 8543..8604 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (8543) | 8543..8604 | - | 62 | NuclAT_1 | - | Antitoxin |
| M9O78_RS23780 (8648) | 8648..8797 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M9O78_RS23785 (9081) | 9081..9338 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| M9O78_RS23790 (9355) | 9355..9606 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| M9O78_RS23795 (9597) | 9597..9644 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| M9O78_RS23800 (9637) | 9637..10119 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| M9O78_RS23805 (10112) | 10112..10969 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| M9O78_RS23810 (11936) | 11936..12187 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| M9O78_RS23815 (12184) | 12184..12471 | + | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M9O78_RS23820 (12575) | 12575..12895 | + | 321 | Protein_14 | serine acetyltransferase | - |
| M9O78_RS23825 (12911) | 12911..13258 | - | 348 | Protein_15 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..203859 | 203859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T246213 WP_001312851.1 NZ_CP097727:8648-8797 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT246213 NZ_CP097727:c8604-8543 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|