Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4087129..4087387 | Replicon | chromosome |
| Accession | NZ_CP097726 | ||
| Organism | Escherichia coli strain MS1050 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | M9O78_RS19360 | Protein ID | WP_000809168.1 |
| Coordinates | 4087235..4087387 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4087129..4087186 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O78_RS19345 | 4083521..4084480 | + | 960 | WP_000871674.1 | hypothetical protein | - |
| M9O78_RS19350 | 4084518..4085417 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| M9O78_RS19355 | 4085483..4086649 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 4087129..4087186 | - | 58 | - | - | Antitoxin |
| M9O78_RS19360 | 4087235..4087387 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| M9O78_RS19365 | 4087491..4088621 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| M9O78_RS19370 | 4088710..4090626 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| M9O78_RS19375 | 4091002..4091406 | + | 405 | WP_000843584.1 | DUF2541 family protein | - |
| M9O78_RS19380 | 4091432..4092145 | + | 714 | WP_001102367.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T246209 WP_000809168.1 NZ_CP097726:4087235-4087387 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246209 NZ_CP097726:c4087186-4087129 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|