Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 4030455..4030864 | Replicon | chromosome |
| Accession | NZ_CP097724 | ||
| Organism | Escherichia coli strain MS1494 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | M9O75_RS19575 | Protein ID | WP_001534835.1 |
| Coordinates | 4030526..4030864 (+) | Length | 113 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 4030455..4030531 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O75_RS19565 (4025643) | 4025643..4026953 | + | 1311 | WP_001534837.1 | restriction endonuclease subunit S | - |
| M9O75_RS19570 (4027048) | 4027048..4030311 | + | 3264 | WP_267326316.1 | HsdR family type I site-specific deoxyribonuclease | - |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_11 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_11 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_11 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_11 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (4030455) | 4030455..4030531 | - | 77 | NuclAT_12 | - | Antitoxin |
| M9O75_RS19575 (4030526) | 4030526..4030864 | + | 339 | WP_001534835.1 | endoribonuclease SymE | Toxin |
| M9O75_RS19580 (4030952) | 4030952..4031086 | - | 135 | WP_001314403.1 | hypothetical protein | - |
| M9O75_RS19585 (4031248) | 4031248..4031556 | + | 309 | Protein_3836 | winged helix-turn-helix domain-containing protein | - |
| M9O75_RS19590 (4031548) | 4031548..4032468 | - | 921 | WP_000181193.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| M9O75_RS19595 (4032653) | 4032653..4033933 | + | 1281 | WP_001535800.1 | DUF445 domain-containing protein | - |
| M9O75_RS19600 (4034049) | 4034049..4035200 | + | 1152 | WP_001338076.1 | double-cubane-cluster-containing anaerobic reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12310.04 Da Isoelectric Point: 7.8226
>T246189 WP_001534835.1 NZ_CP097724:4030526-4030864 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVISNKTPR
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVISNKTPR
Download Length: 339 bp
Antitoxin
Download Length: 77 bp
>AT246189 NZ_CP097724:c4030531-4030455 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|