Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3952440..3952698 | Replicon | chromosome |
Accession | NZ_CP097724 | ||
Organism | Escherichia coli strain MS1494 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | M9O75_RS19190 | Protein ID | WP_000809168.1 |
Coordinates | 3952546..3952698 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3952440..3952497 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O75_RS19175 | 3948269..3949528 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
M9O75_RS19180 | 3949657..3951150 | - | 1494 | WP_001468392.1 | sulfatase-like hydrolase/transferase | - |
M9O75_RS19185 | 3951170..3951931 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
- | 3952440..3952497 | - | 58 | - | - | Antitoxin |
M9O75_RS19190 | 3952546..3952698 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
M9O75_RS19195 | 3952803..3953933 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
M9O75_RS19200 | 3954022..3955938 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
M9O75_RS19205 | 3956311..3956715 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
M9O75_RS19210 | 3956741..3957454 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T246188 WP_000809168.1 NZ_CP097724:3952546-3952698 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246188 NZ_CP097724:c3952497-3952440 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|