Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4519317..4519919 | Replicon | chromosome |
| Accession | NZ_CP097721 | ||
| Organism | Escherichia coli strain MS1665 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | M9O79_RS21610 | Protein ID | WP_000897305.1 |
| Coordinates | 4519608..4519919 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9O79_RS21605 | Protein ID | WP_000356397.1 |
| Coordinates | 4519317..4519607 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O79_RS21580 (4515243) | 4515243..4516145 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| M9O79_RS21585 (4516142) | 4516142..4516777 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M9O79_RS21590 (4516774) | 4516774..4517703 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| M9O79_RS21595 (4518033) | 4518033..4518275 | - | 243 | WP_001086388.1 | protein YiiF | - |
| M9O79_RS21600 (4518494) | 4518494..4518712 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
| M9O79_RS21605 (4519317) | 4519317..4519607 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| M9O79_RS21610 (4519608) | 4519608..4519919 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| M9O79_RS21615 (4520148) | 4520148..4521056 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| M9O79_RS21620 (4521120) | 4521120..4522061 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M9O79_RS21625 (4522106) | 4522106..4522543 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| M9O79_RS21630 (4522540) | 4522540..4523412 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| M9O79_RS21635 (4523406) | 4523406..4524005 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| M9O79_RS21640 (4524104) | 4524104..4524889 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T246169 WP_000897305.1 NZ_CP097721:c4519919-4519608 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|