Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 603643..604442 | Replicon | chromosome |
Accession | NZ_CP097721 | ||
Organism | Escherichia coli strain MS1665 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | M9O79_RS02950 | Protein ID | WP_000347267.1 |
Coordinates | 603643..604107 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M9O79_RS02955 | Protein ID | WP_001307405.1 |
Coordinates | 604107..604442 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O79_RS02920 (598644) | 598644..599078 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M9O79_RS02925 (599096) | 599096..599974 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M9O79_RS02930 (599964) | 599964..600743 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M9O79_RS02935 (600754) | 600754..601227 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M9O79_RS02940 (601250) | 601250..602530 | - | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M9O79_RS02945 (602779) | 602779..603588 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M9O79_RS02950 (603643) | 603643..604107 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M9O79_RS02955 (604107) | 604107..604442 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M9O79_RS02960 (604591) | 604591..606162 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
M9O79_RS02965 (606537) | 606537..607871 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
M9O79_RS02970 (607887) | 607887..608657 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T246150 WP_000347267.1 NZ_CP097721:c604107-603643 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |