Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4954006..4954608 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | M9O74_RS24340 | Protein ID | WP_000897305.1 |
| Coordinates | 4954297..4954608 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9O74_RS24335 | Protein ID | WP_000356397.1 |
| Coordinates | 4954006..4954296 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS24315 (4950508) | 4950508..4951410 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| M9O74_RS24320 (4951407) | 4951407..4952042 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M9O74_RS24325 (4952039) | 4952039..4952968 | + | 930 | WP_039025804.1 | formate dehydrogenase accessory protein FdhE | - |
| M9O74_RS24330 (4953183) | 4953183..4953401 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| M9O74_RS24335 (4954006) | 4954006..4954296 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| M9O74_RS24340 (4954297) | 4954297..4954608 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| M9O74_RS24345 (4954837) | 4954837..4955745 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
| M9O74_RS24350 (4955809) | 4955809..4956750 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M9O74_RS24355 (4956795) | 4956795..4957232 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| M9O74_RS24360 (4957229) | 4957229..4958101 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| M9O74_RS24365 (4958095) | 4958095..4958694 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T246141 WP_000897305.1 NZ_CP097719:c4954608-4954297 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|