Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3703672..3704351 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | M9O74_RS18320 | Protein ID | WP_000057523.1 |
| Coordinates | 3704049..3704351 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | M9O74_RS18315 | Protein ID | WP_000806442.1 |
| Coordinates | 3703672..3704013 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS18305 (3699915) | 3699915..3700847 | - | 933 | WP_000883024.1 | glutaminase A | - |
| M9O74_RS18310 (3701110) | 3701110..3703614 | + | 2505 | WP_000083999.1 | copper-exporting P-type ATPase CopA | - |
| M9O74_RS18315 (3703672) | 3703672..3704013 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| M9O74_RS18320 (3704049) | 3704049..3704351 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9O74_RS18325 (3704484) | 3704484..3705278 | + | 795 | WP_000365161.1 | TraB/GumN family protein | - |
| M9O74_RS18330 (3705482) | 3705482..3705961 | + | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| M9O74_RS18335 (3705998) | 3705998..3707650 | - | 1653 | Protein_3595 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| M9O74_RS18340 (3707868) | 3707868..3709088 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3695558..3704351 | 8793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T246135 WP_000057523.1 NZ_CP097719:c3704351-3704049 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|