Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 639008..639807 | Replicon | chromosome |
Accession | NZ_CP097719 | ||
Organism | Escherichia coli strain MS1679 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | M9O74_RS03145 | Protein ID | WP_000347251.1 |
Coordinates | 639008..639472 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | M9O74_RS03150 | Protein ID | WP_001296435.1 |
Coordinates | 639472..639807 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O74_RS03115 (634009) | 634009..634443 | - | 435 | WP_000948823.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M9O74_RS03120 (634461) | 634461..635339 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M9O74_RS03125 (635329) | 635329..636108 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M9O74_RS03130 (636119) | 636119..636592 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M9O74_RS03135 (636615) | 636615..637895 | - | 1281 | WP_000681938.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M9O74_RS03140 (638144) | 638144..638953 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M9O74_RS03145 (639008) | 639008..639472 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M9O74_RS03150 (639472) | 639472..639807 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M9O74_RS03155 (639956) | 639956..641527 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
M9O74_RS03160 (641902) | 641902..643236 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
M9O74_RS03165 (643252) | 643252..644022 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T246121 WP_000347251.1 NZ_CP097719:c639472-639008 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |