Detailed information of TA system TA246112

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 131543..131964
• Replicon: plasmid pMS1718-1
• Accession: NZ_CP097717
• Organism: Escherichia coli strain MS1718

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M9O77_RS25140
• Protein ID: WP_001375150.1
• Coordinates: 131848..131964 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	131543..131741 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M9O77_RS25105 (126646)	126646..127155	-	510	WP_071600123.1	hypothetical protein	-
M9O77_RS25110 (127473)	127473..128012	+	540	WP_000290801.1	single-stranded DNA-binding protein	-
M9O77_RS25115 (128069)	128069..128302	+	234	WP_000005990.1	DUF905 family protein	-
M9O77_RS25120 (128368)	128368..130326	+	1959	WP_029487628.1	ParB/RepB/Spo0J family partition protein	-
M9O77_RS25125 (130381)	130381..130815	+	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
M9O77_RS25130 (130812)	130812..131574	+	763	Protein_132	plasmid SOS inhibition protein A	-
- (131543)	131543..131741	+	199	NuclAT_0	-	Antitoxin
- (131543)	131543..131741	+	199	NuclAT_0	-	Antitoxin
- (131543)	131543..131741	+	199	NuclAT_0	-	Antitoxin
- (131543)	131543..131741	+	199	NuclAT_0	-	Antitoxin
M9O77_RS25135 (131748)	131748..131897	+	150	Protein_133	DUF5431 family protein	-
M9O77_RS25140 (131848)	131848..131964	+	117	WP_001375150.1	type I toxin-antitoxin system Hok family toxin	Toxin
M9O77_RS25145 (132265)	132265..132561	-	297	Protein_135	hypothetical protein	-
M9O77_RS25150 (132631)	132631..132837	+	207	WP_000547965.1	hypothetical protein	-
M9O77_RS25155 (132862)	132862..133149	+	288	WP_000107546.1	hypothetical protein	-
M9O77_RS25160 (133268)	133268..134089	+	822	WP_001234475.1	DUF932 domain-containing protein	-
M9O77_RS25165 (134384)	134384..134974	-	591	WP_166494936.1	transglycosylase SLT domain-containing protein	-
M9O77_RS25170 (135326)	135326..135709	+	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M9O77_RS25175 (135901)	135901..136548	+	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
M9O77_RS25180 (136684)	136684..136899	+	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	qnrS1 / tet(A) / sitABCD	vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..170336	170336

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4481.27 Da
• Isoelectric Point: 8.4890

>T246112 WP_001375150.1 NZ_CP097717:131848-131964 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT246112 NZ_CP097717:131543-131741 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin