Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 4342333..4342745 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | M9O77_RS20730 | Protein ID | WP_000132601.1 |
Coordinates | 4342404..4342745 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4342333..4342409 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS20720 (4339196) | 4339196..4340785 | + | 1590 | WP_001063200.1 | type I restriction-modification system methyltransferase | - |
M9O77_RS20725 (4340782) | 4340782..4342176 | + | 1395 | WP_001272445.1 | type I restriction-modification system specificity subunit | - |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4342333) | 4342333..4342409 | - | 77 | NuclAT_8 | - | Antitoxin |
M9O77_RS20730 (4342404) | 4342404..4342745 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
M9O77_RS20735 (4342907) | 4342907..4344286 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
M9O77_RS20740 (4344286) | 4344286..4345332 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T246102 WP_000132601.1 NZ_CP097716:4342404-4342745 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT246102 NZ_CP097716:c4342409-4342333 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|