Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3985073..3985767 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | M9O77_RS19070 | Protein ID | WP_001263491.1 |
Coordinates | 3985073..3985471 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | M9O77_RS19075 | Protein ID | WP_000554755.1 |
Coordinates | 3985474..3985767 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS19040 (3980335) | 3980335..3981792 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
M9O77_RS19045 (3981801) | 3981801..3982082 | + | 282 | WP_022645226.1 | hypothetical protein | - |
M9O77_RS19050 (3982099) | 3982099..3982608 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
M9O77_RS19055 (3982670) | 3982670..3983284 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
M9O77_RS19060 (3983281) | 3983281..3984420 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
M9O77_RS19065 (3984611) | 3984611..3985063 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
M9O77_RS19070 (3985073) | 3985073..3985471 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M9O77_RS19075 (3985474) | 3985474..3985767 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M9O77_RS19080 (3985819) | 3985819..3986874 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
M9O77_RS19085 (3986945) | 3986945..3987730 | - | 786 | WP_000207551.1 | putative lateral flagellar export/assembly protein LafU | - |
M9O77_RS19090 (3987702) | 3987702..3989414 | + | 1713 | Protein_3743 | flagellar biosynthesis protein FlhA | - |
M9O77_RS19095 (3989512) | 3989512..3990285 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
M9O77_RS19100 (3990471) | 3990471..3990731 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T246100 WP_001263491.1 NZ_CP097716:c3985471-3985073 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |