Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3690416..3691095 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A1A1R1 |
Locus tag | M9O77_RS17705 | Protein ID | WP_000057541.1 |
Coordinates | 3690793..3691095 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M9O77_RS17700 | Protein ID | WP_000806442.1 |
Coordinates | 3690416..3690757 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS17690 (3686659) | 3686659..3687591 | - | 933 | WP_000883035.1 | glutaminase A | - |
M9O77_RS17695 (3687854) | 3687854..3690358 | + | 2505 | WP_001601790.1 | copper-exporting P-type ATPase CopA | - |
M9O77_RS17700 (3690416) | 3690416..3690757 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M9O77_RS17705 (3690793) | 3690793..3691095 | - | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9O77_RS17710 (3691228) | 3691228..3692022 | + | 795 | WP_000365164.1 | TraB/GumN family protein | - |
M9O77_RS17715 (3692226) | 3692226..3692705 | + | 480 | WP_000186627.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M9O77_RS17720 (3692742) | 3692742..3694394 | - | 1653 | WP_077516164.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
M9O77_RS17725 (3694612) | 3694612..3695832 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T246096 WP_000057541.1 NZ_CP097716:c3691095-3690793 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1A1R1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EBY | |
AlphaFold DB | S1QAY3 |