Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41892..42156 | Replicon | plasmid pMS1718-2 |
| Accession | NZ_CP097713 | ||
| Organism | Escherichia coli strain MS1737 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | M9O76_RS24405 | Protein ID | WP_001331364.1 |
| Coordinates | 41892..42044 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 42099..42156 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O76_RS24375 (37170) | 37170..39332 | + | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
| M9O76_RS24380 (39397) | 39397..40059 | + | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| M9O76_RS24385 (40131) | 40131..40340 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| M9O76_RS24390 (40732) | 40732..40908 | + | 177 | WP_001054904.1 | hypothetical protein | - |
| M9O76_RS24395 (40973) | 40973..41269 | - | 297 | WP_001275298.1 | DinQ-like type I toxin DqlB | - |
| M9O76_RS24400 (41680) | 41680..41820 | + | 141 | WP_000880644.1 | hypothetical protein | - |
| M9O76_RS24405 (41892) | 41892..42044 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (42099) | 42099..42156 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (42099) | 42099..42156 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (42099) | 42099..42156 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (42099) | 42099..42156 | + | 58 | NuclAT_0 | - | Antitoxin |
| M9O76_RS24410 (42336) | 42336..43544 | + | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
| M9O76_RS24415 (43563) | 43563..44633 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| M9O76_RS24420 (44626) | 44626..46917 | + | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) | - | 1..122563 | 122563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T246077 WP_001331364.1 NZ_CP097713:c42044-41892 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246077 NZ_CP097713:42099-42156 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|