Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41892..42156 Replicon plasmid pMS1718-2
Accession NZ_CP097713
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M9O76_RS24405 Protein ID WP_001331364.1
Coordinates 41892..42044 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 42099..42156 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS24375 (37170) 37170..39332 + 2163 WP_000698351.1 DotA/TraY family protein -
M9O76_RS24380 (39397) 39397..40059 + 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
M9O76_RS24385 (40131) 40131..40340 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
M9O76_RS24390 (40732) 40732..40908 + 177 WP_001054904.1 hypothetical protein -
M9O76_RS24395 (40973) 40973..41269 - 297 WP_001275298.1 DinQ-like type I toxin DqlB -
M9O76_RS24400 (41680) 41680..41820 + 141 WP_000880644.1 hypothetical protein -
M9O76_RS24405 (41892) 41892..42044 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (42099) 42099..42156 + 58 NuclAT_0 - Antitoxin
- (42099) 42099..42156 + 58 NuclAT_0 - Antitoxin
- (42099) 42099..42156 + 58 NuclAT_0 - Antitoxin
- (42099) 42099..42156 + 58 NuclAT_0 - Antitoxin
M9O76_RS24410 (42336) 42336..43544 + 1209 WP_000121274.1 IncI1-type conjugal transfer protein TrbA -
M9O76_RS24415 (43563) 43563..44633 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
M9O76_RS24420 (44626) 44626..46917 + 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) - 1..122563 122563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T246077 WP_001331364.1 NZ_CP097713:c42044-41892 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT246077 NZ_CP097713:42099-42156 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References