Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59509..59763 | Replicon | plasmid pMS1718-1 |
| Accession | NZ_CP097712 | ||
| Organism | Escherichia coli strain MS1737 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M9O76_RS23555 | Protein ID | WP_001312851.1 |
| Coordinates | 59509..59658 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59702..59763 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O76_RS23510 (55052) | 55052..55399 | + | 348 | Protein_65 | IS1-like element IS1A family transposase | - |
| M9O76_RS23515 (55415) | 55415..55735 | - | 321 | Protein_66 | serine acetyltransferase | - |
| M9O76_RS23520 (55839) | 55839..56126 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M9O76_RS23525 (56123) | 56123..56374 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| M9O76_RS23530 (57337) | 57337..58194 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| M9O76_RS23535 (58187) | 58187..58669 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| M9O76_RS23540 (58662) | 58662..58709 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| M9O76_RS23545 (58700) | 58700..58951 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| M9O76_RS23550 (58968) | 58968..59225 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| M9O76_RS23555 (59509) | 59509..59658 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (59702) | 59702..59763 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (59702) | 59702..59763 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (59702) | 59702..59763 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (59702) | 59702..59763 | + | 62 | NuclAT_1 | - | Antitoxin |
| M9O76_RS23560 (60019) | 60019..60093 | - | 75 | Protein_75 | endonuclease | - |
| M9O76_RS23565 (60339) | 60339..60551 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| M9O76_RS23570 (60687) | 60687..61247 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| M9O76_RS23575 (61350) | 61350..62210 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| M9O76_RS23580 (62269) | 62269..63015 | - | 747 | WP_094284642.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iucA / iucB / iucC / iucD / iutA / iroB / iroC / iroD / iroE / iroN | 1..188685 | 188685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T246069 WP_001312851.1 NZ_CP097712:c59658-59509 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT246069 NZ_CP097712:59702-59763 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
