Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4030458..4030867 | Replicon | chromosome |
Accession | NZ_CP097711 | ||
Organism | Escherichia coli strain MS1737 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | M9O76_RS19585 | Protein ID | WP_001534835.1 |
Coordinates | 4030529..4030867 (+) | Length | 113 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4030458..4030534 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O76_RS19575 (4025646) | 4025646..4026956 | + | 1311 | WP_001534837.1 | restriction endonuclease subunit S | - |
M9O76_RS19580 (4027051) | 4027051..4030314 | + | 3264 | WP_267326316.1 | HsdR family type I site-specific deoxyribonuclease | - |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_11 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4030458) | 4030458..4030534 | - | 77 | NuclAT_12 | - | Antitoxin |
M9O76_RS19585 (4030529) | 4030529..4030867 | + | 339 | WP_001534835.1 | endoribonuclease SymE | Toxin |
M9O76_RS19590 (4030955) | 4030955..4031089 | - | 135 | WP_001314403.1 | hypothetical protein | - |
M9O76_RS19595 (4031251) | 4031251..4031559 | + | 309 | Protein_3838 | winged helix-turn-helix domain-containing protein | - |
M9O76_RS19600 (4031551) | 4031551..4032471 | - | 921 | WP_000181193.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
M9O76_RS19605 (4032656) | 4032656..4033936 | + | 1281 | WP_001535800.1 | DUF445 domain-containing protein | - |
M9O76_RS19610 (4034052) | 4034052..4035203 | + | 1152 | WP_001338076.1 | double-cubane-cluster-containing anaerobic reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12310.04 Da Isoelectric Point: 7.8226
>T246066 WP_001534835.1 NZ_CP097711:4030529-4030867 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVISNKTPR
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQDFIGVISNKTPR
Download Length: 339 bp
Antitoxin
Download Length: 77 bp
>AT246066 NZ_CP097711:c4030534-4030458 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|