Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3952443..3952701 | Replicon | chromosome |
| Accession | NZ_CP097711 | ||
| Organism | Escherichia coli strain MS1737 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | M9O76_RS19200 | Protein ID | WP_000809168.1 |
| Coordinates | 3952549..3952701 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3952443..3952500 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O76_RS19185 | 3948272..3949531 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
| M9O76_RS19190 | 3949660..3951153 | - | 1494 | WP_001468392.1 | sulfatase-like hydrolase/transferase | - |
| M9O76_RS19195 | 3951173..3951934 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
| - | 3952443..3952500 | - | 58 | - | - | Antitoxin |
| M9O76_RS19200 | 3952549..3952701 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| M9O76_RS19205 | 3952806..3953936 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| M9O76_RS19210 | 3954025..3955941 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| M9O76_RS19215 | 3956314..3956718 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
| M9O76_RS19220 | 3956744..3957457 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T246065 WP_000809168.1 NZ_CP097711:3952549-3952701 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246065 NZ_CP097711:c3952500-3952443 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|