Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1209559..1210286 | Replicon | chromosome |
Accession | NZ_CP097711 | ||
Organism | Escherichia coli strain MS1737 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q3YYE6 |
Locus tag | M9O76_RS05870 | Protein ID | WP_000547563.1 |
Coordinates | 1209559..1209870 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M9O76_RS05875 | Protein ID | WP_000126304.1 |
Coordinates | 1209867..1210286 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O76_RS05840 (1204703) | 1204703..1206412 | + | 1710 | WP_001288123.1 | formate hydrogenlyase subunit HycE | - |
M9O76_RS05845 (1206422) | 1206422..1206964 | + | 543 | WP_000493800.1 | formate hydrogenlyase subunit HycF | - |
M9O76_RS05850 (1206964) | 1206964..1207731 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
M9O76_RS05855 (1207728) | 1207728..1208138 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
M9O76_RS05860 (1208131) | 1208131..1208598 | + | 468 | WP_000132955.1 | hydrogenase maturation peptidase HycI | - |
M9O76_RS05865 (1208641) | 1208641..1209396 | + | 756 | WP_087904422.1 | hypothetical protein | - |
M9O76_RS05870 (1209559) | 1209559..1209870 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
M9O76_RS05875 (1209867) | 1209867..1210286 | + | 420 | WP_000126304.1 | helix-turn-helix domain-containing protein | Antitoxin |
M9O76_RS05880 (1210378) | 1210378..1210806 | - | 429 | WP_000536066.1 | DUF4259 domain-containing protein | - |
M9O76_RS05885 (1211191) | 1211191..1211718 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
M9O76_RS05890 (1211871) | 1211871..1214123 | + | 2253 | WP_001535518.1 | carbamoyltransferase HypF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T246055 WP_000547563.1 NZ_CP097711:1209559-1209870 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15474.50 Da Isoelectric Point: 4.4596
>AT246055 WP_000126304.1 NZ_CP097711:1209867-1210286 [Escherichia coli]
MTANAVRAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAVRAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|