Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 178769..178991 Replicon chromosome
Accession NZ_CP097711
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name ldrD Uniprot ID A0A0D6GD35
Locus tag M9O76_RS00840 Protein ID WP_000170745.1
Coordinates 178884..178991 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 178769..178827 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS00820 174210..175112 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
M9O76_RS00825 175123..176106 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
M9O76_RS00830 176103..177107 + 1005 WP_000103583.1 dipeptide ABC transporter ATP-binding subunit DppF -
M9O76_RS00835 177137..178408 - 1272 WP_001467807.1 amino acid permease -
- 178769..178827 - 59 - - Antitoxin
M9O76_RS00840 178884..178991 + 108 WP_000170745.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
M9O76_RS00845 179078..180757 - 1680 WP_000191567.1 cellulose biosynthesis protein BcsG -
M9O76_RS00850 180754..180945 - 192 WP_000988311.1 cellulose biosynthesis protein BcsF -
M9O76_RS00855 180942..182513 - 1572 WP_001204945.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
M9O76_RS00860 182786..182974 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
M9O76_RS00865 182986..183738 + 753 WP_000279525.1 cellulose biosynthesis protein BcsQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3855.68 Da        Isoelectric Point: 9.0157

>T246052 WP_000170745.1 NZ_CP097711:178884-178991 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT246052 NZ_CP097711:c178827-178769 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6GD35

Antitoxin

Download structure file

References