Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2489769..2490544 | Replicon | chromosome |
Accession | NZ_CP097710 | ||
Organism | Pseudomonas aeruginosa strain PA-2 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V6ADY6 |
Locus tag | M8342_RS11910 | Protein ID | WP_009518525.1 |
Coordinates | 2490086..2490544 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V6AEP7 |
Locus tag | M8342_RS11905 | Protein ID | WP_023098543.1 |
Coordinates | 2489769..2490086 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8342_RS11885 (M8342_11880) | 2484939..2486327 | - | 1389 | Protein_2348 | efflux RND transporter permease subunit | - |
M8342_RS11890 (M8342_11885) | 2486464..2487375 | + | 912 | WP_023098540.1 | NAD(P)H-binding protein | - |
M8342_RS11895 (M8342_11890) | 2487524..2487670 | + | 147 | WP_023098541.1 | MerR family DNA-binding transcriptional regulator | - |
M8342_RS11900 (M8342_11895) | 2487652..2489469 | - | 1818 | WP_023098542.1 | MobH family relaxase | - |
M8342_RS11905 (M8342_11900) | 2489769..2490086 | + | 318 | WP_023098543.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
M8342_RS11910 (M8342_11905) | 2490086..2490544 | + | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
M8342_RS11915 (M8342_11910) | 2490571..2490948 | + | 378 | WP_009518524.1 | DUF3742 family protein | - |
M8342_RS11920 (M8342_11915) | 2490964..2492481 | - | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
M8342_RS11925 (M8342_11920) | 2492496..2492855 | - | 360 | WP_009518522.1 | hypothetical protein | - |
M8342_RS11930 (M8342_11925) | 2492852..2494246 | - | 1395 | WP_009518521.1 | integrating conjugative element protein | - |
M8342_RS11935 (M8342_11930) | 2494256..2495203 | - | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2415305..2552355 | 137050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T246047 WP_009518525.1 NZ_CP097710:2490086-2490544 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|