Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5961069..5961664 | Replicon | chromosome |
Accession | NZ_CP097709 | ||
Organism | Pseudomonas aeruginosa strain PA-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | M8341_RS28080 | Protein ID | WP_003117425.1 |
Coordinates | 5961386..5961664 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M8341_RS28075 | Protein ID | WP_003113527.1 |
Coordinates | 5961069..5961374 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8341_RS28040 (M8341_28035) | 5956208..5957056 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
M8341_RS28050 (M8341_28045) | 5957223..5958164 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
M8341_RS28055 (M8341_28050) | 5958281..5958895 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
M8341_RS28060 (M8341_28055) | 5958937..5959521 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
M8341_RS28065 (M8341_28060) | 5959562..5960662 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
M8341_RS28075 (M8341_28070) | 5961069..5961374 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
M8341_RS28080 (M8341_28075) | 5961386..5961664 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8341_RS28085 (M8341_28080) | 5961717..5961845 | - | 129 | Protein_5556 | integrase | - |
M8341_RS28090 (M8341_28085) | 5961993..5964221 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
M8341_RS28095 (M8341_28090) | 5964291..5964938 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M8341_RS28100 (M8341_28095) | 5965000..5966238 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T246044 WP_003117425.1 NZ_CP097709:c5961664-5961386 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|