Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2488666..2489441 | Replicon | chromosome |
| Accession | NZ_CP097709 | ||
| Organism | Pseudomonas aeruginosa strain PA-1 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V6ADY6 |
| Locus tag | M8341_RS11900 | Protein ID | WP_009518525.1 |
| Coordinates | 2488983..2489441 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | V6AEP7 |
| Locus tag | M8341_RS11895 | Protein ID | WP_023098543.1 |
| Coordinates | 2488666..2488983 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8341_RS11875 (M8341_11870) | 2483836..2485224 | - | 1389 | Protein_2346 | efflux RND transporter permease subunit | - |
| M8341_RS11880 (M8341_11875) | 2485361..2486272 | + | 912 | WP_023098540.1 | NAD(P)H-binding protein | - |
| M8341_RS11885 (M8341_11880) | 2486421..2486567 | + | 147 | WP_023098541.1 | MerR family DNA-binding transcriptional regulator | - |
| M8341_RS11890 (M8341_11885) | 2486549..2488366 | - | 1818 | WP_023098542.1 | MobH family relaxase | - |
| M8341_RS11895 (M8341_11890) | 2488666..2488983 | + | 318 | WP_023098543.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| M8341_RS11900 (M8341_11895) | 2488983..2489441 | + | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| M8341_RS11905 (M8341_11900) | 2489468..2489845 | + | 378 | WP_009518524.1 | DUF3742 family protein | - |
| M8341_RS11910 (M8341_11905) | 2489861..2491378 | - | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| M8341_RS11915 (M8341_11910) | 2491393..2491752 | - | 360 | WP_009518522.1 | hypothetical protein | - |
| M8341_RS11920 (M8341_11915) | 2491749..2493143 | - | 1395 | WP_009518521.1 | integrating conjugative element protein | - |
| M8341_RS11925 (M8341_11920) | 2493153..2494100 | - | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2414202..2551252 | 137050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T246040 WP_009518525.1 NZ_CP097709:2488983-2489441 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|