Detailed information of TA system TA246035

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 75436..75705
• Replicon: plasmid unnamed4
• Accession: NZ_CP097707
• Organism: Klebsiella pneumoniae strain IR12197_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3X87_RS28920
• Protein ID: WP_001372321.1
• Coordinates: 75580..75705 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	75436..75501 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3X87_RS28890	71146..71673	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3X87_RS28895	71731..71964	+	234	WP_000006003.1	DUF905 family protein	-
M3X87_RS28900	72025..74048	+	2024	Protein_90	ParB/RepB/Spo0J family partition protein	-
M3X87_RS28905	74117..74551	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3X87_RS28910	74548..75267	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	75279..75503	+	225	NuclAT_0	-	-
-	75279..75503	+	225	NuclAT_0	-	-
-	75279..75503	+	225	NuclAT_0	-	-
-	75279..75503	+	225	NuclAT_0	-	-
-	75436..75501	-	66	-	-	Antitoxin
M3X87_RS28915	75489..75638	+	150	Protein_93	plasmid maintenance protein Mok	-
M3X87_RS28920	75580..75705	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3X87_RS28925	76024..76320	-	297	Protein_95	hypothetical protein	-
M3X87_RS28930	76620..76916	+	297	WP_001272251.1	hypothetical protein	-
M3X87_RS28935	77027..77848	+	822	WP_001234445.1	DUF932 domain-containing protein	-
M3X87_RS28940	78145..78792	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
M3X87_RS28945	79069..79452	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M3X87_RS28950	79643..80328	+	686	Protein_100	PAS domain-containing protein	-
M3X87_RS28955	80422..80649	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-65 / rmtB / blaKPC-2	-	1..159393	159393

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T246035 WP_001372321.1 NZ_CP097707:75580-75705 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT246035 NZ_CP097707:c75501-75436 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin