Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 75436..75705 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP097707 | ||
| Organism | Klebsiella pneumoniae strain IR12197_1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M3X87_RS28920 | Protein ID | WP_001372321.1 |
| Coordinates | 75580..75705 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 75436..75501 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X87_RS28890 | 71146..71673 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| M3X87_RS28895 | 71731..71964 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| M3X87_RS28900 | 72025..74048 | + | 2024 | Protein_90 | ParB/RepB/Spo0J family partition protein | - |
| M3X87_RS28905 | 74117..74551 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M3X87_RS28910 | 74548..75267 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 75279..75503 | + | 225 | NuclAT_0 | - | - |
| - | 75279..75503 | + | 225 | NuclAT_0 | - | - |
| - | 75279..75503 | + | 225 | NuclAT_0 | - | - |
| - | 75279..75503 | + | 225 | NuclAT_0 | - | - |
| - | 75436..75501 | - | 66 | - | - | Antitoxin |
| M3X87_RS28915 | 75489..75638 | + | 150 | Protein_93 | plasmid maintenance protein Mok | - |
| M3X87_RS28920 | 75580..75705 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M3X87_RS28925 | 76024..76320 | - | 297 | Protein_95 | hypothetical protein | - |
| M3X87_RS28930 | 76620..76916 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| M3X87_RS28935 | 77027..77848 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| M3X87_RS28940 | 78145..78792 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| M3X87_RS28945 | 79069..79452 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M3X87_RS28950 | 79643..80328 | + | 686 | Protein_100 | PAS domain-containing protein | - |
| M3X87_RS28955 | 80422..80649 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 / rmtB / blaKPC-2 | - | 1..159393 | 159393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T246035 WP_001372321.1 NZ_CP097707:75580-75705 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT246035 NZ_CP097707:c75501-75436 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|