Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 43409..43662 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP097707 | ||
| Organism | Klebsiella pneumoniae strain IR12197_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X87_RS28695 | Protein ID | WP_001312851.1 |
| Coordinates | 43513..43662 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 43409..43468 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X87_RS28655 (39069) | 39069..39134 | - | 66 | Protein_42 | helix-turn-helix domain-containing protein | - |
| M3X87_RS28660 (39187) | 39187..39891 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X87_RS28665 (39916) | 39916..40116 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X87_RS28670 (40136) | 40136..40882 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X87_RS28675 (40937) | 40937..41497 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X87_RS28680 (41629) | 41629..41829 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X87_RS28685 (42215) | 42215..42814 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X87_RS28690 (42876) | 42876..43208 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (43409) | 43409..43468 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (43409) | 43409..43468 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (43409) | 43409..43468 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (43409) | 43409..43468 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3X87_RS28695 (43513) | 43513..43662 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3X87_RS28700 (43946) | 43946..44194 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X87_RS30125 (44439) | 44439..44513 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X87_RS28715 (44506) | 44506..45363 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X87_RS28720 (46302) | 46302..46955 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X87_RS28725 (47048) | 47048..47305 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X87_RS28730 (47238) | 47238..47639 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3X87_RS28735 (47888) | 47888..48303 | + | 416 | Protein_57 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 / rmtB / blaKPC-2 | - | 1..159393 | 159393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T246031 WP_001312851.1 NZ_CP097707:43513-43662 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT246031 NZ_CP097707:c43468-43409 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
