Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 298987..299573 Replicon chromosome
Accession NZ_CP097703
Organism Klebsiella pneumoniae strain IR12197_1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M3X87_RS01365 Protein ID WP_002920800.1
Coordinates 299205..299573 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag M3X87_RS01360 Protein ID WP_002920802.1
Coordinates 298987..299208 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X87_RS01340 (M3X87_01340) 295144..296070 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M3X87_RS01345 (M3X87_01345) 296067..297344 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
M3X87_RS01350 (M3X87_01350) 297341..298108 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M3X87_RS01355 (M3X87_01355) 298110..298823 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M3X87_RS01360 (M3X87_01360) 298987..299208 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M3X87_RS01365 (M3X87_01365) 299205..299573 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M3X87_RS01370 (M3X87_01370) 299846..301162 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M3X87_RS01375 (M3X87_01375) 301269..302156 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M3X87_RS01380 (M3X87_01380) 302153..302998 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M3X87_RS01385 (M3X87_01385) 303000..304070 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 296067..304807 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246018 WP_002920800.1 NZ_CP097703:299205-299573 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT246018 WP_002920802.1 NZ_CP097703:298987-299208 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References