Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 9262..9919 Replicon plasmid unnamed4
Accession NZ_CP097701
Organism Klebsiella pneumoniae strain IR12183_1

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag M3X92_RS27635 Protein ID WP_000270043.1
Coordinates 9262..9612 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M3X92_RS27640 Protein ID WP_000124640.1
Coordinates 9617..9919 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X92_RS27600 (M3X92_27600) 5736..6233 - 498 WP_000062185.1 hypothetical protein -
M3X92_RS27605 (M3X92_27605) 6236..6724 - 489 WP_001273096.1 DUF1643 domain-containing protein -
M3X92_RS27610 (M3X92_27610) 6821..7156 + 336 WP_000683476.1 hypothetical protein -
M3X92_RS27615 (M3X92_27615) 7171..7641 - 471 WP_001281821.1 hypothetical protein -
M3X92_RS27620 (M3X92_27620) 7634..8005 - 372 WP_000516916.1 hypothetical protein -
M3X92_RS27625 (M3X92_27625) 8016..8210 - 195 WP_000343597.1 hypothetical protein -
M3X92_RS27630 (M3X92_27630) 8551..9099 - 549 WP_001061574.1 transcriptional regulator -
M3X92_RS27635 (M3X92_27635) 9262..9612 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M3X92_RS27640 (M3X92_27640) 9617..9919 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
M3X92_RS27645 (M3X92_27645) 9946..10239 - 294 WP_001239997.1 chromosome segregation protein ParM -
M3X92_RS27650 (M3X92_27650) 10327..10599 - 273 WP_001043047.1 HU family DNA-binding protein -
M3X92_RS27655 (M3X92_27655) 10657..11184 - 528 WP_001236377.1 thermonuclease family protein -
M3X92_RS27660 (M3X92_27660) 11415..12272 - 858 WP_001167032.1 hypothetical protein -
M3X92_RS27665 (M3X92_27665) 12259..12489 - 231 WP_000972663.1 hypothetical protein -
M3X92_RS27670 (M3X92_27670) 12489..13007 - 519 WP_000210756.1 nitrite reductase -
M3X92_RS27675 (M3X92_27675) 13004..13450 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
M3X92_RS27680 (M3X92_27680) 13450..13809 - 360 WP_000422768.1 hypothetical protein -
M3X92_RS27685 (M3X92_27685) 13866..14294 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..52275 52275


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T246017 WP_000270043.1 NZ_CP097701:9262-9612 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT246017 WP_000124640.1 NZ_CP097701:9617-9919 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References