Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 87188..87915 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097696 | ||
| Organism | Klebsiella pneumoniae strain IR12182_1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | M3X85_RS28505 | Protein ID | WP_004118600.1 |
| Coordinates | 87604..87915 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | M3X85_RS28500 | Protein ID | WP_000990392.1 |
| Coordinates | 87188..87607 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X85_RS28465 (M3X85_28465) | 82875..83237 | - | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
| M3X85_RS28470 (M3X85_28470) | 83285..83638 | - | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| M3X85_RS28475 (M3X85_28475) | 83931..84071 | + | 141 | WP_004118614.1 | hypothetical protein | - |
| M3X85_RS28480 (M3X85_28480) | 84239..84547 | + | 309 | WP_020324596.1 | Ref family recombination enhancement nuclease | - |
| M3X85_RS28485 (M3X85_28485) | 84971..85630 | + | 660 | WP_000078540.1 | hypothetical protein | - |
| M3X85_RS28490 (M3X85_28490) | 85627..85956 | + | 330 | WP_004118613.1 | hypothetical protein | - |
| M3X85_RS28495 (M3X85_28495) | 85949..87151 | + | 1203 | WP_003031541.1 | hypothetical protein | - |
| M3X85_RS28500 (M3X85_28500) | 87188..87607 | - | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M3X85_RS28505 (M3X85_28505) | 87604..87915 | - | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M3X85_RS28510 (M3X85_28510) | 88126..88506 | + | 381 | Protein_120 | gluconate permease | - |
| M3X85_RS28515 (M3X85_28515) | 88556..89251 | - | 696 | WP_004118595.1 | lactate utilization protein C | - |
| M3X85_RS28520 (M3X85_28520) | 89244..90671 | - | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| M3X85_RS28525 (M3X85_28525) | 90682..91401 | - | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / dfrA1 / qacE / sul1 / mph(A) | - | 1..214956 | 214956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T246000 WP_004118600.1 NZ_CP097696:c87915-87604 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT246000 WP_000990392.1 NZ_CP097696:c87607-87188 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |