Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 70291..70717 | Replicon | plasmid unnamed1 |
Accession | NZ_CP097695 | ||
Organism | Klebsiella pneumoniae strain IR12182_1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | M3X85_RS27460 | Protein ID | WP_001372321.1 |
Coordinates | 70592..70717 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 70291..70515 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X85_RS27425 (65401) | 65401..65856 | - | 456 | Protein_93 | hypothetical protein | - |
M3X85_RS27430 (66158) | 66158..66685 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
M3X85_RS27435 (66743) | 66743..66976 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
M3X85_RS27440 (67037) | 67037..69060 | + | 2024 | Protein_96 | ParB/RepB/Spo0J family partition protein | - |
M3X85_RS27445 (69129) | 69129..69563 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
M3X85_RS27450 (69560) | 69560..70279 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- (70291) | 70291..70515 | + | 225 | NuclAT_0 | - | Antitoxin |
- (70291) | 70291..70515 | + | 225 | NuclAT_0 | - | Antitoxin |
- (70291) | 70291..70515 | + | 225 | NuclAT_0 | - | Antitoxin |
- (70291) | 70291..70515 | + | 225 | NuclAT_0 | - | Antitoxin |
M3X85_RS27455 (70501) | 70501..70650 | + | 150 | Protein_99 | plasmid maintenance protein Mok | - |
M3X85_RS27460 (70592) | 70592..70717 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
M3X85_RS27465 (71036) | 71036..71332 | - | 297 | Protein_101 | hypothetical protein | - |
M3X85_RS27470 (71632) | 71632..71928 | + | 297 | WP_001272251.1 | hypothetical protein | - |
M3X85_RS27475 (72039) | 72039..72860 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
M3X85_RS27480 (73157) | 73157..73804 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
M3X85_RS27485 (74081) | 74081..74464 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
M3X85_RS27490 (74655) | 74655..75341 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
M3X85_RS27495 (75435) | 75435..75662 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / rmtB / blaTEM-1B | - | 1..131777 | 131777 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245995 WP_001372321.1 NZ_CP097695:70592-70717 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT245995 NZ_CP097695:70291-70515 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|