Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328770..329356 Replicon chromosome
Accession NZ_CP097694
Organism Klebsiella pneumoniae strain IR12182_1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M3X85_RS01525 Protein ID WP_002920800.1
Coordinates 328988..329356 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag M3X85_RS01520 Protein ID WP_002920802.1
Coordinates 328770..328991 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X85_RS01500 (M3X85_01500) 324927..325853 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M3X85_RS01505 (M3X85_01505) 325850..327127 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
M3X85_RS01510 (M3X85_01510) 327124..327891 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M3X85_RS01515 (M3X85_01515) 327893..328606 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M3X85_RS01520 (M3X85_01520) 328770..328991 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M3X85_RS01525 (M3X85_01525) 328988..329356 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M3X85_RS01530 (M3X85_01530) 329629..330945 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M3X85_RS01535 (M3X85_01535) 331052..331939 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M3X85_RS01540 (M3X85_01540) 331936..332781 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M3X85_RS01545 (M3X85_01545) 332783..333853 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325850..334590 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T245977 WP_002920800.1 NZ_CP097694:328988-329356 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT245977 WP_002920802.1 NZ_CP097694:328770-328991 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References