Detailed information of TA system TA245973

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 60322..60748
• Replicon: plasmid unnamed1
• Accession: NZ_CP097693
• Organism: Klebsiella pneumoniae strain IR12094_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3T51_RS27580
• Protein ID: WP_001372321.1
• Coordinates: 60322..60447 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	60524..60748 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3T51_RS27545 (55377)	55377..55604	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
M3T51_RS27550 (55698)	55698..56384	-	687	WP_015059009.1	PAS domain-containing protein	-
M3T51_RS27555 (56575)	56575..56958	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M3T51_RS27560 (57235)	57235..57882	+	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
M3T51_RS27565 (58179)	58179..59000	-	822	WP_001234445.1	DUF932 domain-containing protein	-
M3T51_RS27570 (59111)	59111..59407	-	297	WP_001272251.1	hypothetical protein	-
M3T51_RS27575 (59707)	59707..60003	+	297	Protein_89	hypothetical protein	-
M3T51_RS27580 (60322)	60322..60447	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3T51_RS27585 (60389)	60389..60538	-	150	Protein_91	plasmid maintenance protein Mok	-
- (60524)	60524..60748	-	225	NuclAT_0	-	Antitoxin
- (60524)	60524..60748	-	225	NuclAT_0	-	Antitoxin
- (60524)	60524..60748	-	225	NuclAT_0	-	Antitoxin
- (60524)	60524..60748	-	225	NuclAT_0	-	Antitoxin
M3T51_RS27590 (60760)	60760..61479	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
M3T51_RS27595 (61476)	61476..61910	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3T51_RS27600 (61979)	61979..64002	-	2024	Protein_94	ParB/RepB/Spo0J family partition protein	-
M3T51_RS27605 (64063)	64063..64296	-	234	WP_000006003.1	DUF905 family protein	-
M3T51_RS27610 (64354)	64354..64881	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3T51_RS27615 (65183)	65183..65644	+	462	Protein_97	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	catA2 / blaCTX-M-65 / fosA3 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2	-	1..130677	130677

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245973 WP_001372321.1 NZ_CP097693:c60447-60322 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT245973 NZ_CP097693:c60748-60524 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin