Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38719..38972 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097693 | ||
| Organism | Klebsiella pneumoniae strain IR12094_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3T51_RS27415 | Protein ID | WP_001312851.1 |
| Coordinates | 38823..38972 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 38719..38778 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T51_RS27375 (34379) | 34379..34444 | - | 66 | Protein_50 | helix-turn-helix domain-containing protein | - |
| M3T51_RS27380 (34497) | 34497..35201 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3T51_RS27385 (35226) | 35226..35426 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3T51_RS27390 (35446) | 35446..36192 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3T51_RS27395 (36247) | 36247..36807 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3T51_RS27400 (36939) | 36939..37139 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3T51_RS27405 (37525) | 37525..38124 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3T51_RS27410 (38186) | 38186..38518 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (38719) | 38719..38778 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (38719) | 38719..38778 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (38719) | 38719..38778 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (38719) | 38719..38778 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3T51_RS27415 (38823) | 38823..38972 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3T51_RS27420 (39256) | 39256..39504 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3T51_RS28065 (39749) | 39749..39823 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3T51_RS27435 (39816) | 39816..40673 | + | 858 | WP_142295464.1 | incFII family plasmid replication initiator RepA | - |
| M3T51_RS27440 (41612) | 41612..42265 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3T51_RS27445 (42358) | 42358..42615 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3T51_RS27450 (42548) | 42548..42949 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3T51_RS27455 (43198) | 43198..43613 | + | 416 | Protein_65 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | catA2 / blaCTX-M-65 / fosA3 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2 | - | 1..130677 | 130677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245970 WP_001312851.1 NZ_CP097693:38823-38972 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245970 NZ_CP097693:c38778-38719 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
