Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72330..72583 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097691 | ||
| Organism | Klebsiella pneumoniae strain IR12079_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X89_RS30055 | Protein ID | WP_001312851.1 |
| Coordinates | 72434..72583 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 72330..72389 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X89_RS30015 (67990) | 67990..68055 | - | 66 | Protein_93 | helix-turn-helix domain-containing protein | - |
| M3X89_RS30020 (68108) | 68108..68812 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X89_RS30025 (68837) | 68837..69037 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X89_RS30030 (69057) | 69057..69803 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X89_RS30035 (69858) | 69858..70418 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X89_RS30040 (70550) | 70550..70750 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X89_RS30045 (71136) | 71136..71735 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X89_RS30050 (71797) | 71797..72129 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (72330) | 72330..72389 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (72330) | 72330..72389 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (72330) | 72330..72389 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (72330) | 72330..72389 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3X89_RS30055 (72434) | 72434..72583 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3X89_RS30060 (72867) | 72867..73115 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X89_RS30180 (73360) | 73360..73434 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X89_RS30075 (73427) | 73427..74284 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X89_RS30080 (75223) | 75223..75876 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X89_RS30085 (75969) | 75969..76226 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X89_RS30090 (76159) | 76159..76560 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3X89_RS30095 (76809) | 76809..77224 | + | 416 | Protein_108 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaCTX-M-65 | - | 1..85555 | 85555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245953 WP_001312851.1 NZ_CP097691:72434-72583 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245953 NZ_CP097691:c72389-72330 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
