Detailed information of TA system TA245951

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25014..25283
• Replicon: plasmid unnamed3
• Accession: NZ_CP097691
• Organism: Klebsiella pneumoniae strain IR12079_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3X89_RS29725
• Protein ID: WP_001372321.1
• Coordinates: 25158..25283 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25014..25079 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3X89_RS29695	20724..21251	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3X89_RS29700	21309..21542	+	234	WP_000006003.1	DUF905 family protein	-
M3X89_RS29705	21603..23626	+	2024	Protein_31	ParB/RepB/Spo0J family partition protein	-
M3X89_RS29710	23695..24129	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3X89_RS29715	24126..24845	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	24857..25081	+	225	NuclAT_0	-	-
-	24857..25081	+	225	NuclAT_0	-	-
-	24857..25081	+	225	NuclAT_0	-	-
-	24857..25081	+	225	NuclAT_0	-	-
-	25014..25079	-	66	-	-	Antitoxin
M3X89_RS29720	25067..25216	+	150	Protein_34	plasmid maintenance protein Mok	-
M3X89_RS29725	25158..25283	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3X89_RS29730	25752..26456	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
M3X89_RS29735	26521..26802	+	282	Protein_37	DNA methyltransferase	-
M3X89_RS29740	26802..27023	+	222	WP_015493077.1	hypothetical protein	-
M3X89_RS29745	27034..27453	+	420	WP_015493076.1	DUF1380 family protein	-
M3X89_RS29750	27507..28286	+	780	WP_015493075.1	hypothetical protein	-
M3X89_RS29755	28691..29197	+	507	WP_015493074.1	antirestriction protein ArdA	-
M3X89_RS29760	29240..29431	+	192	WP_015493073.1	hypothetical protein	-
M3X89_RS29765	29624..29878	+	255	WP_015493072.1	DNA polymerase III subunit theta	-
M3X89_RS29770	29913..30230	+	318	Protein_44	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaCTX-M-65	-	1..85555	85555
	-	flank	IS/Tn	-	-	25752..26456	704

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245951 WP_001372321.1 NZ_CP097691:25158-25283 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT245951 NZ_CP097691:c25079-25014 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin