Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 50854..51581 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097689 | ||
| Organism | Klebsiella pneumoniae strain IR12079_1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | M3X89_RS27915 | Protein ID | WP_004118600.1 |
| Coordinates | 50854..51165 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | M3X89_RS27920 | Protein ID | WP_000990392.1 |
| Coordinates | 51162..51581 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X89_RS27895 (M3X89_27895) | 47368..48087 | + | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
| M3X89_RS27900 (M3X89_27900) | 48098..49525 | + | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| M3X89_RS27905 (M3X89_27905) | 49518..50213 | + | 696 | WP_004118595.1 | lactate utilization protein C | - |
| M3X89_RS27910 (M3X89_27910) | 50263..50643 | - | 381 | Protein_47 | gluconate permease | - |
| M3X89_RS27915 (M3X89_27915) | 50854..51165 | + | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M3X89_RS27920 (M3X89_27920) | 51162..51581 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M3X89_RS27925 (M3X89_27925) | 51618..52820 | - | 1203 | WP_003031541.1 | hypothetical protein | - |
| M3X89_RS27930 (M3X89_27930) | 52813..53142 | - | 330 | WP_004118613.1 | hypothetical protein | - |
| M3X89_RS27935 (M3X89_27935) | 53139..53798 | - | 660 | WP_000078540.1 | hypothetical protein | - |
| M3X89_RS27940 (M3X89_27940) | 54222..54530 | - | 309 | WP_020324596.1 | Ref family recombination enhancement nuclease | - |
| M3X89_RS27945 (M3X89_27945) | 54698..54838 | - | 141 | WP_004118614.1 | hypothetical protein | - |
| M3X89_RS27950 (M3X89_27950) | 55131..55484 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| M3X89_RS27955 (M3X89_27955) | 55532..55894 | + | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / dfrA1 / qacE / sul1 / mph(A) / aph(3')-Ia / blaSHV-12 | - | 1..127340 | 127340 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T245945 WP_004118600.1 NZ_CP097689:50854-51165 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT245945 WP_000990392.1 NZ_CP097689:51162-51581 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |