Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 134780..135507 Replicon plasmid unnamed4
Accession NZ_CP097687
Organism Klebsiella pneumoniae strain IR12073_1

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LNL2
Locus tag M3X91_RS29420 Protein ID WP_004118600.1
Coordinates 134780..135091 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag M3X91_RS29425 Protein ID WP_000990392.1
Coordinates 135088..135507 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X91_RS29400 (M3X91_29400) 131294..132013 + 720 WP_001102107.1 (Fe-S)-binding protein -
M3X91_RS29405 (M3X91_29405) 132024..133451 + 1428 WP_000023895.1 LutB/LldF family L-lactate oxidation iron-sulfur protein -
M3X91_RS29410 (M3X91_29410) 133444..134139 + 696 WP_004118595.1 lactate utilization protein C -
M3X91_RS29415 (M3X91_29415) 134189..134569 - 381 Protein_150 gluconate permease -
M3X91_RS29420 (M3X91_29420) 134780..135091 + 312 WP_004118600.1 type II toxin-antitoxin system HigB family toxin Toxin
M3X91_RS29425 (M3X91_29425) 135088..135507 + 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
M3X91_RS29430 (M3X91_29430) 135544..136746 - 1203 WP_003031541.1 hypothetical protein -
M3X91_RS29435 (M3X91_29435) 136739..137068 - 330 WP_004118613.1 hypothetical protein -
M3X91_RS29440 (M3X91_29440) 137065..137724 - 660 WP_000078540.1 hypothetical protein -
M3X91_RS29445 (M3X91_29445) 138148..138504 - 357 WP_077253206.1 Ref family recombination enhancement nuclease -
M3X91_RS29450 (M3X91_29450) 138624..138764 - 141 WP_004118614.1 hypothetical protein -
M3X91_RS29455 (M3X91_29455) 139057..139410 + 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M3X91_RS29460 (M3X91_29460) 139458..139820 + 363 WP_020324593.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / sul1 / qacE / dfrA1 / tet(A) / blaSHV-12 - 1..161025 161025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12386.14 Da        Isoelectric Point: 10.0935

>T245930 WP_004118600.1 NZ_CP097687:134780-135091 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT245930 WP_000990392.1 NZ_CP097687:135088-135507 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNL2

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References