Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 134780..135507 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP097687 | ||
| Organism | Klebsiella pneumoniae strain IR12073_1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | M3X91_RS29420 | Protein ID | WP_004118600.1 |
| Coordinates | 134780..135091 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | M3X91_RS29425 | Protein ID | WP_000990392.1 |
| Coordinates | 135088..135507 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X91_RS29400 (M3X91_29400) | 131294..132013 | + | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
| M3X91_RS29405 (M3X91_29405) | 132024..133451 | + | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| M3X91_RS29410 (M3X91_29410) | 133444..134139 | + | 696 | WP_004118595.1 | lactate utilization protein C | - |
| M3X91_RS29415 (M3X91_29415) | 134189..134569 | - | 381 | Protein_150 | gluconate permease | - |
| M3X91_RS29420 (M3X91_29420) | 134780..135091 | + | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M3X91_RS29425 (M3X91_29425) | 135088..135507 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M3X91_RS29430 (M3X91_29430) | 135544..136746 | - | 1203 | WP_003031541.1 | hypothetical protein | - |
| M3X91_RS29435 (M3X91_29435) | 136739..137068 | - | 330 | WP_004118613.1 | hypothetical protein | - |
| M3X91_RS29440 (M3X91_29440) | 137065..137724 | - | 660 | WP_000078540.1 | hypothetical protein | - |
| M3X91_RS29445 (M3X91_29445) | 138148..138504 | - | 357 | WP_077253206.1 | Ref family recombination enhancement nuclease | - |
| M3X91_RS29450 (M3X91_29450) | 138624..138764 | - | 141 | WP_004118614.1 | hypothetical protein | - |
| M3X91_RS29455 (M3X91_29455) | 139057..139410 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| M3X91_RS29460 (M3X91_29460) | 139458..139820 | + | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-Ia / sul1 / qacE / dfrA1 / tet(A) / blaSHV-12 | - | 1..161025 | 161025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T245930 WP_004118600.1 NZ_CP097687:134780-135091 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT245930 WP_000990392.1 NZ_CP097687:135088-135507 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |