Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 126378..126631 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097686 | ||
| Organism | Klebsiella pneumoniae strain IR12073_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X91_RS28485 | Protein ID | WP_001312851.1 |
| Coordinates | 126482..126631 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 126378..126437 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X91_RS28445 (122038) | 122038..122103 | - | 66 | Protein_159 | helix-turn-helix domain-containing protein | - |
| M3X91_RS28450 (122156) | 122156..122860 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X91_RS28455 (122885) | 122885..123085 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X91_RS28460 (123105) | 123105..123851 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X91_RS28465 (123906) | 123906..124466 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X91_RS28470 (124598) | 124598..124798 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X91_RS28475 (125184) | 125184..125783 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X91_RS28480 (125845) | 125845..126177 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (126378) | 126378..126437 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (126378) | 126378..126437 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (126378) | 126378..126437 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (126378) | 126378..126437 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3X91_RS28485 (126482) | 126482..126631 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3X91_RS28490 (126915) | 126915..127163 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X91_RS29655 (127408) | 127408..127482 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X91_RS28505 (127475) | 127475..128332 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X91_RS28510 (129271) | 129271..129924 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X91_RS28515 (130017) | 130017..130274 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X91_RS28520 (130207) | 130207..130608 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3X91_RS28525 (130857) | 130857..131272 | + | 416 | Protein_174 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / catA2 / blaCTX-M-65 | - | 1..153836 | 153836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245924 WP_001312851.1 NZ_CP097686:126482-126631 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245924 NZ_CP097686:c126437-126378 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
