Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25100..25353 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097682 | ||
| Organism | Klebsiella pneumoniae strain IR12061_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X88_RS28845 | Protein ID | WP_001312851.1 |
| Coordinates | 25204..25353 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 25100..25159 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X88_RS28800 (20335) | 20335..20640 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| M3X88_RS28805 (20660) | 20660..20824 | + | 165 | Protein_35 | TraE/TraK family type IV conjugative transfer system protein | - |
| M3X88_RS28810 (20878) | 20878..21582 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X88_RS28815 (21607) | 21607..21807 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X88_RS28820 (21827) | 21827..22573 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X88_RS28825 (22628) | 22628..23188 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X88_RS28830 (23320) | 23320..23520 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X88_RS28835 (23906) | 23906..24505 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X88_RS28840 (24567) | 24567..24899 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (25100) | 25100..25159 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (25100) | 25100..25159 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (25100) | 25100..25159 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (25100) | 25100..25159 | - | 60 | NuclAT_0 | - | Antitoxin |
| M3X88_RS28845 (25204) | 25204..25353 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3X88_RS28850 (25637) | 25637..25885 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X88_RS29120 (26130) | 26130..26204 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X88_RS28865 (26197) | 26197..27054 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X88_RS28870 (27993) | 27993..28646 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X88_RS28875 (28739) | 28739..28996 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X88_RS28880 (28929) | 28929..29330 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3X88_RS28885 (29579) | 29579..29994 | + | 416 | Protein_50 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / blaKPC-2 | - | 1..57847 | 57847 | |
| - | flank | IS/Tn | - | - | 20878..21582 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245903 WP_001312851.1 NZ_CP097682:25204-25353 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245903 NZ_CP097682:c25159-25100 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
