Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 96714..97140 | Replicon | plasmid unnamed1 |
Accession | NZ_CP097680 | ||
Organism | Klebsiella pneumoniae strain IR12061_1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | M3X88_RS27400 | Protein ID | WP_001372321.1 |
Coordinates | 97015..97140 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 96714..96938 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X88_RS27360 (91794) | 91794..92024 | + | 231 | WP_001333093.1 | hypothetical protein | - |
M3X88_RS27365 (91946) | 91946..92194 | + | 249 | WP_071606928.1 | hypothetical protein | - |
M3X88_RS27370 (92664) | 92664..93191 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
M3X88_RS27375 (93247) | 93247..93480 | + | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
M3X88_RS27380 (93539) | 93539..95497 | + | 1959 | WP_032152921.1 | ParB/RepB/Spo0J family partition protein | - |
M3X88_RS27385 (95552) | 95552..95986 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
M3X88_RS27390 (95983) | 95983..96745 | + | 763 | Protein_108 | plasmid SOS inhibition protein A | - |
- (96714) | 96714..96938 | + | 225 | NuclAT_0 | - | Antitoxin |
- (96714) | 96714..96938 | + | 225 | NuclAT_0 | - | Antitoxin |
- (96714) | 96714..96938 | + | 225 | NuclAT_0 | - | Antitoxin |
- (96714) | 96714..96938 | + | 225 | NuclAT_0 | - | Antitoxin |
M3X88_RS27395 (96924) | 96924..97073 | + | 150 | Protein_109 | plasmid maintenance protein Mok | - |
M3X88_RS27400 (97015) | 97015..97140 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
M3X88_RS27405 (97360) | 97360..97590 | + | 231 | WP_071587244.1 | hypothetical protein | - |
M3X88_RS27410 (97588) | 97588..97761 | - | 174 | Protein_112 | hypothetical protein | - |
M3X88_RS27415 (98059) | 98059..98345 | + | 287 | Protein_113 | hypothetical protein | - |
M3X88_RS27420 (98466) | 98466..99287 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
M3X88_RS27425 (99584) | 99584..100222 | - | 639 | WP_281440555.1 | transglycosylase SLT domain-containing protein | - |
M3X88_RS27430 (100517) | 100517..100900 | + | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
M3X88_RS27435 (101094) | 101094..101780 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
M3X88_RS27440 (101874) | 101874..102101 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(3)-IId | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..274502 | 274502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245899 WP_001372321.1 NZ_CP097680:97015-97140 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT245899 NZ_CP097680:96714-96938 [Klebsiella pneumoniae]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|