Detailed information of TA system TA245899

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 96714..97140
• Replicon: plasmid unnamed1
• Accession: NZ_CP097680
• Organism: Klebsiella pneumoniae strain IR12061_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3X88_RS27400
• Protein ID: WP_001372321.1
• Coordinates: 97015..97140 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	96714..96938 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3X88_RS27360 (91794)	91794..92024	+	231	WP_001333093.1	hypothetical protein	-
M3X88_RS27365 (91946)	91946..92194	+	249	WP_071606928.1	hypothetical protein	-
M3X88_RS27370 (92664)	92664..93191	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
M3X88_RS27375 (93247)	93247..93480	+	234	WP_000006018.1	DUF905 domain-containing protein	-
M3X88_RS27380 (93539)	93539..95497	+	1959	WP_032152921.1	ParB/RepB/Spo0J family partition protein	-
M3X88_RS27385 (95552)	95552..95986	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
M3X88_RS27390 (95983)	95983..96745	+	763	Protein_108	plasmid SOS inhibition protein A	-
- (96714)	96714..96938	+	225	NuclAT_0	-	Antitoxin
- (96714)	96714..96938	+	225	NuclAT_0	-	Antitoxin
- (96714)	96714..96938	+	225	NuclAT_0	-	Antitoxin
- (96714)	96714..96938	+	225	NuclAT_0	-	Antitoxin
M3X88_RS27395 (96924)	96924..97073	+	150	Protein_109	plasmid maintenance protein Mok	-
M3X88_RS27400 (97015)	97015..97140	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3X88_RS27405 (97360)	97360..97590	+	231	WP_071587244.1	hypothetical protein	-
M3X88_RS27410 (97588)	97588..97761	-	174	Protein_112	hypothetical protein	-
M3X88_RS27415 (98059)	98059..98345	+	287	Protein_113	hypothetical protein	-
M3X88_RS27420 (98466)	98466..99287	+	822	WP_001234469.1	DUF932 domain-containing protein	-
M3X88_RS27425 (99584)	99584..100222	-	639	WP_281440555.1	transglycosylase SLT domain-containing protein	-
M3X88_RS27430 (100517)	100517..100900	+	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M3X88_RS27435 (101094)	101094..101780	+	687	WP_000332487.1	PAS domain-containing protein	-
M3X88_RS27440 (101874)	101874..102101	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(3)-IId	rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB	1..274502	274502

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245899 WP_001372321.1 NZ_CP097680:97015-97140 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT245899 NZ_CP097680:96714-96938 [Klebsiella pneumoniae]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin