Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 33336..34063 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097680 | ||
| Organism | Klebsiella pneumoniae strain IR12061_1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | M3X88_RS27040 | Protein ID | WP_011251285.1 |
| Coordinates | 33336..33647 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M3X88_RS27045 | Protein ID | WP_011251286.1 |
| Coordinates | 33644..34063 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X88_RS27000 (28347) | 28347..28841 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| M3X88_RS27005 (28847) | 28847..29287 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| M3X88_RS27010 (29712) | 29712..30668 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| M3X88_RS27015 (30728) | 30728..31069 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| M3X88_RS27020 (31083) | 31083..31394 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| M3X88_RS27025 (31411) | 31411..31860 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| M3X88_RS27035 (32694) | 32694..33131 | + | 438 | Protein_37 | DDE-type integrase/transposase/recombinase | - |
| M3X88_RS27040 (33336) | 33336..33647 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M3X88_RS27045 (33644) | 33644..34063 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M3X88_RS27050 (34210) | 34210..35178 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| M3X88_RS27055 (35250) | 35250..35615 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| M3X88_RS27060 (35629) | 35629..36417 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| M3X88_RS27065 (36438) | 36438..37058 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| M3X88_RS27070 (37477) | 37477..38112 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| M3X88_RS27075 (38425) | 38425..38895 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(3)-IId | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..274502 | 274502 | |
| - | inside | IScluster/Tn | - | - | 26427..44184 | 17757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T245897 WP_011251285.1 NZ_CP097680:33336-33647 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT245897 WP_011251286.1 NZ_CP097680:33644-34063 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|