Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 89192..89461 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097677 | ||
| Organism | Klebsiella pneumoniae strain IR12024_1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M3T48_RS27905 | Protein ID | WP_001372321.1 |
| Coordinates | 89336..89461 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 89192..89257 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T48_RS27875 | 84902..85429 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| M3T48_RS27880 | 85487..85720 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| M3T48_RS27885 | 85781..87804 | + | 2024 | Protein_121 | ParB/RepB/Spo0J family partition protein | - |
| M3T48_RS27890 | 87873..88307 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M3T48_RS27895 | 88304..89023 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 89035..89259 | + | 225 | NuclAT_0 | - | - |
| - | 89035..89259 | + | 225 | NuclAT_0 | - | - |
| - | 89035..89259 | + | 225 | NuclAT_0 | - | - |
| - | 89035..89259 | + | 225 | NuclAT_0 | - | - |
| - | 89192..89257 | - | 66 | - | - | Antitoxin |
| M3T48_RS27900 | 89245..89394 | + | 150 | Protein_124 | plasmid maintenance protein Mok | - |
| M3T48_RS27905 | 89336..89461 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M3T48_RS27910 | 89780..90076 | - | 297 | Protein_126 | hypothetical protein | - |
| M3T48_RS27915 | 90427..91131 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3T48_RS27920 | 91194..91589 | + | 396 | Protein_128 | ATP-dependent endonuclease | - |
| M3T48_RS27925 | 91574..92596 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| M3T48_RS27930 | 92852..93549 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| M3T48_RS27935 | 93578..93850 | + | 273 | Protein_131 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..162611 | 162611 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245879 WP_001372321.1 NZ_CP097677:89336-89461 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT245879 NZ_CP097677:c89257-89192 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|