Detailed information of TA system TA245879

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 89192..89461
• Replicon: plasmid unnamed2
• Accession: NZ_CP097677
• Organism: Klebsiella pneumoniae strain IR12024_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3T48_RS27905
• Protein ID: WP_001372321.1
• Coordinates: 89336..89461 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	89192..89257 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3T48_RS27875	84902..85429	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3T48_RS27880	85487..85720	+	234	WP_000006003.1	DUF905 family protein	-
M3T48_RS27885	85781..87804	+	2024	Protein_121	ParB/RepB/Spo0J family partition protein	-
M3T48_RS27890	87873..88307	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3T48_RS27895	88304..89023	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	89035..89259	+	225	NuclAT_0	-	-
-	89035..89259	+	225	NuclAT_0	-	-
-	89035..89259	+	225	NuclAT_0	-	-
-	89035..89259	+	225	NuclAT_0	-	-
-	89192..89257	-	66	-	-	Antitoxin
M3T48_RS27900	89245..89394	+	150	Protein_124	plasmid maintenance protein Mok	-
M3T48_RS27905	89336..89461	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3T48_RS27910	89780..90076	-	297	Protein_126	hypothetical protein	-
M3T48_RS27915	90427..91131	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
M3T48_RS27920	91194..91589	+	396	Protein_128	ATP-dependent endonuclease	-
M3T48_RS27925	91574..92596	+	1023	WP_000361404.1	helicase UvrD	-
M3T48_RS27930	92852..93549	+	698	WP_223174630.1	IS1 family transposase	-
M3T48_RS27935	93578..93850	+	273	Protein_131	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12	-	1..162611	162611

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245879 WP_001372321.1 NZ_CP097677:89336-89461 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT245879 NZ_CP097677:c89257-89192 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin