Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 89035..89461 | Replicon | plasmid unnamed2 |
Accession | NZ_CP097677 | ||
Organism | Klebsiella pneumoniae strain IR12024_1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | M3T48_RS27905 | Protein ID | WP_001372321.1 |
Coordinates | 89336..89461 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 89035..89259 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3T48_RS27870 (84145) | 84145..84600 | - | 456 | Protein_118 | hypothetical protein | - |
M3T48_RS27875 (84902) | 84902..85429 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
M3T48_RS27880 (85487) | 85487..85720 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
M3T48_RS27885 (85781) | 85781..87804 | + | 2024 | Protein_121 | ParB/RepB/Spo0J family partition protein | - |
M3T48_RS27890 (87873) | 87873..88307 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
M3T48_RS27895 (88304) | 88304..89023 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- (89035) | 89035..89259 | + | 225 | NuclAT_0 | - | Antitoxin |
- (89035) | 89035..89259 | + | 225 | NuclAT_0 | - | Antitoxin |
- (89035) | 89035..89259 | + | 225 | NuclAT_0 | - | Antitoxin |
- (89035) | 89035..89259 | + | 225 | NuclAT_0 | - | Antitoxin |
M3T48_RS27900 (89245) | 89245..89394 | + | 150 | Protein_124 | plasmid maintenance protein Mok | - |
M3T48_RS27905 (89336) | 89336..89461 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
M3T48_RS27910 (89780) | 89780..90076 | - | 297 | Protein_126 | hypothetical protein | - |
M3T48_RS27915 (90427) | 90427..91131 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
M3T48_RS27920 (91194) | 91194..91589 | + | 396 | Protein_128 | ATP-dependent endonuclease | - |
M3T48_RS27925 (91574) | 91574..92596 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
M3T48_RS27930 (92852) | 92852..93549 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
M3T48_RS27935 (93578) | 93578..93850 | + | 273 | Protein_131 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..162611 | 162611 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245878 WP_001372321.1 NZ_CP097677:89336-89461 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT245878 NZ_CP097677:89035-89259 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|