Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49625..49878 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097677 | ||
| Organism | Klebsiella pneumoniae strain IR12024_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3T48_RS27635 | Protein ID | WP_001312851.1 |
| Coordinates | 49729..49878 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 49625..49684 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T48_RS27590 (44680) | 44680..44892 | - | 213 | WP_014343500.1 | hypothetical protein | - |
| M3T48_RS27595 (44953) | 44953..45309 | - | 357 | WP_014343501.1 | hypothetical protein | - |
| M3T48_RS27600 (45403) | 45403..46107 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3T48_RS27605 (46132) | 46132..46332 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3T48_RS27610 (46352) | 46352..47098 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3T48_RS27615 (47153) | 47153..47713 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3T48_RS27620 (47845) | 47845..48045 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3T48_RS27625 (48431) | 48431..49030 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3T48_RS27630 (49092) | 49092..49424 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (49625) | 49625..49684 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (49625) | 49625..49684 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (49625) | 49625..49684 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (49625) | 49625..49684 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3T48_RS27635 (49729) | 49729..49878 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3T48_RS27640 (50162) | 50162..50410 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3T48_RS29890 (50655) | 50655..50729 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3T48_RS27655 (50722) | 50722..51579 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3T48_RS27660 (52518) | 52518..53171 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3T48_RS27665 (53264) | 53264..53521 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3T48_RS27670 (53454) | 53454..53855 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3T48_RS27675 (54104) | 54104..54519 | + | 416 | Protein_79 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..162611 | 162611 | |
| - | flank | IS/Tn | - | - | 45403..46107 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245875 WP_001312851.1 NZ_CP097677:49729-49878 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245875 NZ_CP097677:c49684-49625 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
