Detailed information of TA system TA245858

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 253816..254085
• Replicon: plasmid unnamed3
• Accession: NZ_CP097673
• Organism: Klebsiella pneumoniae strain IR5077_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3X94_RS28980
• Protein ID: WP_001372321.1
• Coordinates: 253960..254085 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	253816..253881 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3X94_RS28950	249526..250053	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3X94_RS28955	250111..250344	+	234	WP_000006003.1	DUF905 family protein	-
M3X94_RS28960	250405..252428	+	2024	Protein_287	ParB/RepB/Spo0J family partition protein	-
M3X94_RS28965	252497..252931	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3X94_RS28970	252928..253647	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	253659..253883	+	225	NuclAT_0	-	-
-	253659..253883	+	225	NuclAT_0	-	-
-	253659..253883	+	225	NuclAT_0	-	-
-	253659..253883	+	225	NuclAT_0	-	-
-	253816..253881	-	66	-	-	Antitoxin
M3X94_RS28975	253869..254018	+	150	Protein_290	plasmid maintenance protein Mok	-
M3X94_RS28980	253960..254085	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3X94_RS28985	254404..254700	-	297	Protein_292	hypothetical protein	-
M3X94_RS28990	255000..255296	+	297	WP_001272251.1	hypothetical protein	-
M3X94_RS28995	255407..256228	+	822	WP_001234445.1	DUF932 domain-containing protein	-
M3X94_RS29000	256525..257172	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
M3X94_RS29005	257449..257832	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M3X94_RS29010	258023..258709	+	687	WP_015059009.1	PAS domain-containing protein	-
M3X94_RS29015	258803..259030	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB	rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA	1..292919	292919

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245858 WP_001372321.1 NZ_CP097673:253960-254085 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT245858 NZ_CP097673:c253881-253816 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin