Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 253816..254085 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097673 | ||
| Organism | Klebsiella pneumoniae strain IR5077_1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M3X94_RS28980 | Protein ID | WP_001372321.1 |
| Coordinates | 253960..254085 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 253816..253881 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X94_RS28950 | 249526..250053 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| M3X94_RS28955 | 250111..250344 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| M3X94_RS28960 | 250405..252428 | + | 2024 | Protein_287 | ParB/RepB/Spo0J family partition protein | - |
| M3X94_RS28965 | 252497..252931 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M3X94_RS28970 | 252928..253647 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 253659..253883 | + | 225 | NuclAT_0 | - | - |
| - | 253659..253883 | + | 225 | NuclAT_0 | - | - |
| - | 253659..253883 | + | 225 | NuclAT_0 | - | - |
| - | 253659..253883 | + | 225 | NuclAT_0 | - | - |
| - | 253816..253881 | - | 66 | - | - | Antitoxin |
| M3X94_RS28975 | 253869..254018 | + | 150 | Protein_290 | plasmid maintenance protein Mok | - |
| M3X94_RS28980 | 253960..254085 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M3X94_RS28985 | 254404..254700 | - | 297 | Protein_292 | hypothetical protein | - |
| M3X94_RS28990 | 255000..255296 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| M3X94_RS28995 | 255407..256228 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| M3X94_RS29000 | 256525..257172 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| M3X94_RS29005 | 257449..257832 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M3X94_RS29010 | 258023..258709 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| M3X94_RS29015 | 258803..259030 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..292919 | 292919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245858 WP_001372321.1 NZ_CP097673:253960-254085 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT245858 NZ_CP097673:c253881-253816 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|