Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 215576..215829 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097673 | ||
| Organism | Klebsiella pneumoniae strain IR5077_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X94_RS28715 | Protein ID | WP_001312851.1 |
| Coordinates | 215680..215829 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 215576..215635 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X94_RS28675 (211236) | 211236..211301 | - | 66 | Protein_231 | helix-turn-helix domain-containing protein | - |
| M3X94_RS28680 (211354) | 211354..212058 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X94_RS28685 (212083) | 212083..212283 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X94_RS28690 (212303) | 212303..213049 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X94_RS28695 (213104) | 213104..213664 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X94_RS28700 (213796) | 213796..213996 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X94_RS28705 (214382) | 214382..214981 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X94_RS28710 (215043) | 215043..215375 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (215576) | 215576..215635 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (215576) | 215576..215635 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (215576) | 215576..215635 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (215576) | 215576..215635 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3X94_RS28715 (215680) | 215680..215829 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3X94_RS28720 (216113) | 216113..216361 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X94_RS29900 (216606) | 216606..216680 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X94_RS28735 (216673) | 216673..217530 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X94_RS28740 (218469) | 218469..219122 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X94_RS28745 (219215) | 219215..219472 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X94_RS28750 (219405) | 219405..219806 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3X94_RS28755 (220055) | 220055..220470 | + | 416 | Protein_246 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..292919 | 292919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245854 WP_001312851.1 NZ_CP097673:215680-215829 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245854 NZ_CP097673:c215635-215576 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
