Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 122457..123114 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP097667 | ||
| Organism | Klebsiella pneumoniae strain IR1230_1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | M3X90_RS29005 | Protein ID | WP_000270043.1 |
| Coordinates | 122457..122807 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M3X90_RS29010 | Protein ID | WP_000124640.1 |
| Coordinates | 122812..123114 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X90_RS28960 (M3X90_28960) | 117768..117947 | + | 180 | Protein_128 | helix-turn-helix domain-containing protein | - |
| M3X90_RS28965 (M3X90_28965) | 118012..118716 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X90_RS28970 (M3X90_28970) | 118931..119428 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| M3X90_RS28975 (M3X90_28975) | 119431..119919 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| M3X90_RS28980 (M3X90_28980) | 120016..120351 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| M3X90_RS28985 (M3X90_28985) | 120366..120836 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| M3X90_RS28990 (M3X90_28990) | 120829..121200 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| M3X90_RS28995 (M3X90_28995) | 121211..121405 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| M3X90_RS29000 (M3X90_29000) | 121746..122294 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| M3X90_RS29005 (M3X90_29005) | 122457..122807 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M3X90_RS29010 (M3X90_29010) | 122812..123114 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| M3X90_RS29015 (M3X90_29015) | 123141..123434 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| M3X90_RS29020 (M3X90_29020) | 123522..123794 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| M3X90_RS29025 (M3X90_29025) | 123852..124379 | - | 528 | WP_001236377.1 | thermonuclease family protein | - |
| M3X90_RS29030 (M3X90_29030) | 124610..125467 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| M3X90_RS29035 (M3X90_29035) | 125454..125684 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| M3X90_RS29040 (M3X90_29040) | 125684..126202 | - | 519 | WP_000210756.1 | nitrite reductase | - |
| M3X90_RS29045 (M3X90_29045) | 126199..126645 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| M3X90_RS29050 (M3X90_29050) | 126645..127004 | - | 360 | WP_000422768.1 | hypothetical protein | - |
| M3X90_RS29055 (M3X90_29055) | 127061..127489 | - | 429 | WP_000591074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / dfrA25 / blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..153479 | 153479 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T245835 WP_000270043.1 NZ_CP097667:122457-122807 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|