Detailed information of TA system TA245832

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 132830..133256
• Replicon: plasmid unnamed3
• Accession: NZ_CP097666
• Organism: Klebsiella pneumoniae strain IR1230_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3X90_RS28215
• Protein ID: WP_001372321.1
• Coordinates: 132830..132955 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	133032..133256 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3X90_RS28180 (127886)	127886..128113	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
M3X90_RS28185 (128207)	128207..128893	-	687	WP_015059009.1	PAS domain-containing protein	-
M3X90_RS28190 (129084)	129084..129467	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M3X90_RS28195 (129744)	129744..130391	+	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
M3X90_RS28200 (130688)	130688..131509	-	822	WP_001234445.1	DUF932 domain-containing protein	-
M3X90_RS28205 (131620)	131620..131916	-	297	WP_001272251.1	hypothetical protein	-
M3X90_RS28210 (132233)	132233..132511	+	279	Protein_178	hypothetical protein	-
M3X90_RS28215 (132830)	132830..132955	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3X90_RS28220 (132897)	132897..133046	-	150	Protein_180	plasmid maintenance protein Mok	-
- (133032)	133032..133256	-	225	NuclAT_0	-	Antitoxin
- (133032)	133032..133256	-	225	NuclAT_0	-	Antitoxin
- (133032)	133032..133256	-	225	NuclAT_0	-	Antitoxin
- (133032)	133032..133256	-	225	NuclAT_0	-	Antitoxin
M3X90_RS28225 (133268)	133268..133987	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
M3X90_RS28230 (133984)	133984..134418	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3X90_RS28235 (134487)	134487..136510	-	2024	Protein_183	ParB/RepB/Spo0J family partition protein	-
M3X90_RS28240 (136571)	136571..136804	-	234	WP_000006003.1	DUF905 family protein	-
M3X90_RS28245 (136862)	136862..137389	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3X90_RS28250 (137691)	137691..138146	+	456	Protein_186	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-55 / mph(A) / sul1 / dfrA25 / blaKPC-2 / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id	-	1..147295	147295

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245832 WP_001372321.1 NZ_CP097666:c132955-132830 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT245832 NZ_CP097666:c133256-133032 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin