Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 109063..109316 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097666 | ||
| Organism | Klebsiella pneumoniae strain IR1230_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X90_RS28045 | Protein ID | WP_001312851.1 |
| Coordinates | 109063..109212 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 109257..109316 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X90_RS28010 (104722) | 104722..105084 | - | 363 | Protein_139 | group II intron reverse transcriptase/maturase | - |
| M3X90_RS28015 (105201) | 105201..105389 | + | 189 | WP_000957857.1 | hypothetical protein | - |
| M3X90_RS28020 (105399) | 105399..106598 | + | 1200 | WP_064765287.1 | IS91 family transposase | - |
| M3X90_RS28025 (107362) | 107362..108219 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X90_RS30700 (108212) | 108212..108286 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X90_RS28040 (108531) | 108531..108779 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X90_RS28045 (109063) | 109063..109212 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (109257) | 109257..109316 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (109257) | 109257..109316 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (109257) | 109257..109316 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (109257) | 109257..109316 | + | 60 | NuclAT_1 | - | Antitoxin |
| M3X90_RS28050 (109517) | 109517..109849 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| M3X90_RS28055 (109911) | 109911..110510 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X90_RS28060 (110896) | 110896..111096 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X90_RS28065 (111228) | 111228..111788 | - | 561 | WP_063097573.1 | fertility inhibition protein FinO | - |
| M3X90_RS28070 (111843) | 111843..112166 | - | 324 | Protein_150 | type-F conjugative transfer system pilin acetylase TraX | - |
| M3X90_RS28075 (112220) | 112220..112924 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| M3X90_RS28080 (113516) | 113516..114100 | - | 585 | WP_001137892.1 | macrolide-binding transcriptional repressor MphR(A) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-55 / mph(A) / sul1 / dfrA25 / blaKPC-2 / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..147295 | 147295 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245828 WP_001312851.1 NZ_CP097666:c109212-109063 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245828 NZ_CP097666:109257-109316 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|