Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 107157..107410 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097662 | ||
| Organism | Klebsiella pneumoniae strain IR12243_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X86_RS27975 | Protein ID | WP_001312851.1 |
| Coordinates | 107157..107306 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 107351..107410 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X86_RS27935 (102516) | 102516..102931 | - | 416 | Protein_151 | IS1-like element IS1B family transposase | - |
| M3X86_RS27940 (103180) | 103180..103581 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M3X86_RS27945 (103514) | 103514..103771 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X86_RS27950 (103864) | 103864..104517 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X86_RS27955 (105456) | 105456..106313 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X86_RS28300 (106306) | 106306..106380 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X86_RS27970 (106625) | 106625..106873 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X86_RS27975 (107157) | 107157..107306 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (107351) | 107351..107410 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (107351) | 107351..107410 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (107351) | 107351..107410 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (107351) | 107351..107410 | + | 60 | NuclAT_1 | - | Antitoxin |
| M3X86_RS27980 (107611) | 107611..107943 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| M3X86_RS27985 (108005) | 108005..108604 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X86_RS27990 (108990) | 108990..109190 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X86_RS27995 (109322) | 109322..109882 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X86_RS28000 (109937) | 109937..110683 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X86_RS28005 (110703) | 110703..110903 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X86_RS28010 (110928) | 110928..111632 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / fosA3 / blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 | - | 1..147322 | 147322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245805 WP_001312851.1 NZ_CP097662:c107306-107157 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245805 NZ_CP097662:107351-107410 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
